PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.18685s0003.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 149aa    MW: 16171 Da    PI: 9.7384
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.18685s0003.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.46.4e-382686262
                zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                          ++++l+cprC+stntkfCyynny+ sqPr+fCk+CrryWt+GG+lr++PvGg +rk+ k+s
  Araha.18685s0003.1.p 26 QQEQLPCPRCESTNTKFCYYNNYNFSQPRHFCKSCRRYWTHGGTLRDIPVGGVSRKSSKRS 86
                          57899***************************************************98875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-35274IPR003851Zinc finger, Dof-type
PfamPF027012.8E-332884IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.643084IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103268IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 149 aa     Download sequence    Send to blast
MPSEFSESRR IPKLSHGGDV AIPTDQQEQL PCPRCESTNT KFCYYNNYNF SQPRHFCKSC  60
RRYWTHGGTL RDIPVGGVSR KSSKRSRTCS SAATTTVVGS RNFPLQATPV LFPQSSSNGV  120
STTSKGNASS LYGGQESKVG FVSGDYLA*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00593DAPTransfer from AT5G66940Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0266401e-163AB026640.1 Arabidopsis thaliana genomic DNA, chromosome 5, TAC clone:K8A10.
GenBankAB4938171e-163AB493817.1 Arabidopsis thaliana At5g66940 gene for hypothetical protein, partial cds, clone: RAAt5g66940.
GenBankBT0295231e-163BT029523.1 Arabidopsis thaliana At5g66940 mRNA, complete cds.
GenBankCP0026881e-163CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002865040.12e-92Dof-type zinc finger domain-containing protein
SwissprotQ9FGD61e-86DOF58_ARATH; Dof zinc finger protein DOF5.8
TrEMBLD7MLD92e-92D7MLD9_ARALL; Dof-type zinc finger domain-containing protein
STRINGscaffold_803422.15e-92(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22862874
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66940.12e-67Dof family protein